HPA000646

LGALS1 antibody from Sigma-Aldrich
GBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000646
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000646, RRID:AB_1078935
Product name
Anti-LGALS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000646
Antibody type
Polyclonal
Antigen
Galectin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDAN
TIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITF
DQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDF
KIKCV
Storage
-20C
Provider Type Product Number
- No reagents -