HPA003920

UBE2D4 antibody from Sigma-Aldrich
HBUCE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003920
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003920, RRID:AB_1858519
Product name
Anti-UBE2D4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003920
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 D4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSP
YQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNIN
SNGSICLDILRS
Storage
-20C
Provider Type Product Number
- No reagents -