HPA011055

SNN antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011055, RRID:AB_1857326
Product name
Anti-SNN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011055
Antibody type
Polyclonal
Antigen
Stannin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLM
TPNGPEV
Storage
-20C
Provider Type Product Number
- No reagents -