HPA014957

BRI3BP antibody from Sigma-Aldrich
BNAS1, HCCR-2, KG19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014957
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014957, RRID:AB_1845447
Product name
Anti-BRI3BP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014957
Antibody type
Polyclonal
Antigen
BRI3-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS
SPARALLLVGVV
Storage
-20C
Provider Type Product Number
- No reagents -