Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405736 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Roundabout, Axon Guidance Receptor, Homolog 2 (Drosophila) (ROBO2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ROBO2 antibody: synthetic peptide directed towards the N terminal of human ROBO2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMST
DEGTY MCIAENRVGK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ROBO2 gene variants are associated with familial vesicoureteral reflux.
Bertoli-Avella AM, Conte ML, Punzo F, de Graaf BM, Lama G, La Manna A, Polito C, Grassia C, Nobili B, Rambaldi PF, Oostra BA, Perrotta S
Journal of the American Society of Nephrology : JASN 2008 Apr;19(4):825-31
Journal of the American Society of Nephrology : JASN 2008 Apr;19(4):825-31
No comments: Submit comment
No validations: Submit validation data