HPA013371

ROBO2 antibody from Sigma-Aldrich
KIAA1568
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013371
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013371, RRID:AB_1856391
Product name
Anti-ROBO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013371
Antibody type
Polyclonal
Antigen
Roundabout homolog 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATML
SDGAIYSSIDFTTKTSYNSSSQITQATPYATTQIL
HSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLP
DQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Storage
-20C
Provider Type Product Number
- No reagents -