H00084844-M03
antibody from Abnova Corporation
Targeting: PHF5A
bK223H9.2, INI, MGC1346, Rds3, SAP14b, SF3b14b, SF3B7
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084844-M03 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PHF5A monoclonal antibody (M03), clone 2H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant PHF5A.
- Antigen sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDS
YVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY
YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKY
GFKKR- Isotype
- IgG
- Antibody clone number
- 2H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PHF5A expression in transfected 293T cell line by PHF5A monoclonal antibody (M01), clone 2H7.Lane 1: PHF5A transfected lysate(12.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol