H00084844-M04
antibody from Abnova Corporation
Targeting: PHF5A
bK223H9.2, INI, MGC1346, Rds3, SAP14b, SF3b14b, SF3B7
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084844-M04 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PHF5A monoclonal antibody (M04), clone 1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant PHF5A.
- Antigen sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDS
YVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY
YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKY
GFKKR- Isotype
- IgG
- Antibody clone number
- 1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PHF5A on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol