HPA013372

SEMA4B antibody from Sigma-Aldrich
KIAA1745, MGC131831, SEMAC, SemC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013372
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013372, RRID:AB_1856670
Product name
Anti-SEMA4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013372
Antibody type
Polyclonal
Antigen
Semaphorin-4B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAEHISNYTALLLSRDGRTLYVGAREALFALSSNL
SFLPGGEYQELLWGADAEKKQQCSFKGKDPQRDCQ
NYIKILLPLSGSHLFTCGTAAFSPMCTYINMENFT
LARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGEL
YTGTVSSF
Storage
-20C
Provider Type Product Number
- No reagents -