Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042277 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042277, RRID:AB_10793877
- Product name
- Anti-ITGB7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WCKQLNFTASGEAEARRCARREELLARGCPLEELE
EPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTL
RPGEPQQLQVRFLRAEGYPVDL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Computer-Aided Imaging Analysis of Probe-Based Confocal Laser Endomicroscopy With Molecular Labeling and Gene Expression Identifies Markers of Response to Biological Therapy in IBD Patients: The Endo-Omics Study
Iacucci M, Jeffery L, Acharjee A, Grisan E, Buda A, Nardone O, Smith S, Labarile N, Zardo D, Ungar B, Hunter S, Mao R, Cannatelli R, Shivaji U, Parigi T, Reynolds G, Gkoutos G, Ghosh S
Inflammatory Bowel Diseases 2023;29(9):1409-1420
Inflammatory Bowel Diseases 2023;29(9):1409-1420
No comments: Submit comment
No validations: Submit validation data