HPA017585

SGCZ antibody from Sigma-Aldrich
ZSG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017585, RRID:AB_1856799
Product name
Anti-SGCZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017585
Antibody type
Polyclonal
Antigen
Zeta-sarcoglycan recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLT
GQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDE
ITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDL
Storage
-20C
Provider Type Product Number
- No reagents -