Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023228-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023228-M02, RRID:AB_1112451
- Product name
- PLCL2 monoclonal antibody (M02), clone 1C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLCL2.
- Antigen sequence
RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDV
DNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELH
KSKDKAGTEVTKEEFIEVFH- Isotype
- IgG
- Antibody clone number
- 1C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PLCL2 expression in transfected 293T cell line by PLCL2 monoclonal antibody (M02), clone 1C7.Lane 1: PLCL2 transfected lysate (Predicted MW: 113.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PLCL2 transfected lysate using anti-PLCL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PLCL2 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol