Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503139 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Leucine Rich Repeat Containing 37B (LRRC37B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LRRC37B antibody: synthetic peptide directed towards the N terminal of human LRRC37B
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLS
KPQRQ KQTLPDDYLS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
Douglas J, Cilliers D, Coleman K, Tatton-Brown K, Barker K, Bernhard B, Burn J, Huson S, Josifova D, Lacombe D, Malik M, Mansour S, Reid E, Cormier-Daire V, Cole T, Childhood Overgrowth Collaboration, Rahman N
Nature genetics 2007 Aug;39(8):963-5
Nature genetics 2007 Aug;39(8):963-5
No comments: Submit comment
No validations: Submit validation data