HPA015134

LRRC37B antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015134
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015134, RRID:AB_1853311
Product name
Anti-LRRC37B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015134
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 37B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKM
LQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQL
EIQLTEQLRSLIPNEDVRKFMSHVIRTLK
Storage
-20C
Provider Type Product Number
- No reagents -