HPA013316

GP1BA antibody from Sigma-Aldrich
CD42b, GP1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013316, RRID:AB_1855459
Product name
Anti-GP1BA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013316
Antibody type
Polyclonal
Antigen
Platelet glycoprotein Ib alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVY
VWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKG
CPTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKF
PTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQEST
KEQTT
Storage
-20C
Provider Type Product Number
- No reagents -