HPA013316

GP1BA antibody from Atlas Antibodies
CD42b, GP1B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013316
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013316, RRID:AB_1235270
Product name
Anti-GP1BA
Provider product page
Atlas Antibodies - HPA013316
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVY
VWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKG
CPTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKF
PTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQEST
KEQTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -