HPA010126

CEP104 antibody from Sigma-Aldrich
CFAP256, GlyBP, KIAA0562, ROC22, RP1-286D6.4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010126
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010126, RRID:AB_10601583
Product name
Anti-KIAA0562 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010126
Antibody type
Polyclonal
Antigen
KIAA0562 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIVLQMVERCRIRKLQLLAHQYMISSKIEFYISES
LPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELK
SVYVDAVGQFLKLIFHQNHVNKYNIYNQVALVAIN
IIGDPADFSDESNTASREKLIDHYL
Storage
-20C
Provider Type Product Number
- No reagents -