Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009700-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009700-M01, RRID:AB_489989
- Product name
- ESPL1 monoclonal antibody (M01), clone 6H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ESPL1.
- Antigen sequence
REELQAYKAVRADTGQERFNIICDLLELSPEETPA
GAWARATHLVELAQVLCYHDFTQQTNCSALDAIRE
ALQLLDSVRPEAQARDQLLDDKAQALLWLYICTLE
AKIQEGIERDR- Isotype
- IgG
- Antibody clone number
- 6H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MMTV-Espl1 transgenic mice develop aneuploid, estrogen receptor alpha (ERα)-positive mammary adenocarcinomas.
Identification and Characterization of Separase Inhibitors (Sepins) for Cancer Therapy.
Overexpression and constitutive nuclear localization of cohesin protease Separase protein correlates with high incidence of relapse and reduced overall survival in glioblastoma multiforme.
Separase loss of function cooperates with the loss of p53 in the initiation and progression of T- and B-cell lymphoma, leukemia and aneuploidy in mice.
Calpain-1 cleaves Rad21 to promote sister chromatid separation.
Overexpression and mislocalization of the chromosomal segregation protein separase in multiple human cancers.
Overexpression of Separase induces aneuploidy and mammary tumorigenesis.
Mukherjee M, Ge G, Zhang N, Edwards DG, Sumazin P, Sharan SK, Rao PH, Medina D, Pati D
Oncogene 2014 Nov 27;33(48):5511-22
Oncogene 2014 Nov 27;33(48):5511-22
Identification and Characterization of Separase Inhibitors (Sepins) for Cancer Therapy.
Zhang N, Scorsone K, Ge G, Kaffes CC, Dobrolecki LE, Mukherjee M, Lewis MT, Berg S, Stephan CC, Pati D
Journal of biomolecular screening 2014 Jul;19(6):878-89
Journal of biomolecular screening 2014 Jul;19(6):878-89
Overexpression and constitutive nuclear localization of cohesin protease Separase protein correlates with high incidence of relapse and reduced overall survival in glioblastoma multiforme.
Mukherjee M, Byrd T, Brawley VS, Bielamowicz K, Li XN, Merchant F, Maitra S, Sumazin P, Fuller G, Kew Y, Sun D, Powell SZ, Ahmed N, Zhang N, Pati D
Journal of neuro-oncology 2014 Aug;119(1):27-35
Journal of neuro-oncology 2014 Aug;119(1):27-35
Separase loss of function cooperates with the loss of p53 in the initiation and progression of T- and B-cell lymphoma, leukemia and aneuploidy in mice.
Mukherjee M, Ge G, Zhang N, Huang E, Nakamura LV, Minor M, Fofanov V, Rao PH, Herron A, Pati D
PloS one 2011;6(7):e22167
PloS one 2011;6(7):e22167
Calpain-1 cleaves Rad21 to promote sister chromatid separation.
Panigrahi AK, Zhang N, Mao Q, Pati D
Molecular and cellular biology 2011 Nov;31(21):4335-47
Molecular and cellular biology 2011 Nov;31(21):4335-47
Overexpression and mislocalization of the chromosomal segregation protein separase in multiple human cancers.
Meyer R, Fofanov V, Panigrahi A, Merchant F, Zhang N, Pati D
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Apr 15;15(8):2703-10
Clinical cancer research : an official journal of the American Association for Cancer Research 2009 Apr 15;15(8):2703-10
Overexpression of Separase induces aneuploidy and mammary tumorigenesis.
Zhang N, Ge G, Meyer R, Sethi S, Basu D, Pradhan S, Zhao YJ, Li XN, Cai WW, El-Naggar AK, Baladandayuthapani V, Kittrell FS, Rao PH, Medina D, Pati D
Proceedings of the National Academy of Sciences of the United States of America 2008 Sep 2;105(35):13033-8
Proceedings of the National Academy of Sciences of the United States of America 2008 Sep 2;105(35):13033-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ESPL1 monoclonal antibody (M01), clone 6H6 Western Blot analysis of ESPL1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ESPL1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol