PAB19955

SPIN2B antibody from Abnova Corporation
SPIN-2, TDRD26

Antibody data

Product number
PAB19955
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19955, RRID:AB_10965725
Product name
SPIN2B polyclonal antibody
Provider product page
Abnova Corporation - PAB19955
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SPIN2B.
Antigen sequence
AVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITY
EKDPVLYMYQLLDDYKEGDLRIMPESSESPPTERE
PGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVEAKP
SV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -