HPA000162

SPIN2B antibody from Sigma-Aldrich
SPIN-2, TDRD26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000162
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000162, RRID:AB_1080079
Product name
Anti-SPIN2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000162
Antibody type
Polyclonal
Antigen
Spindlin-2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITY
EKDPVLYMYQLLDDYKEGDLRIMPESSESPPTERE
PGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVEAKP
SV
Storage
-20C
Provider Type Product Number
- No reagents -