HPA017434

METTL7A antibody from Sigma-Aldrich
DKFZP586A0522
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017434
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017434, RRID:AB_1853835
Product name
Anti-METTL7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017434
Antibody type
Polyclonal
Antigen
Methyltransferase-like protein 7A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGP
SGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNF
E
Storage
-20C
Provider Type Product Number
- No reagents -