HPA001205

TMED8 antibody from Atlas Antibodies
FAM15B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001205
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001205, RRID:AB_2204460
Product name
Anti-TMED8
Provider product page
Atlas Antibodies - HPA001205
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQ
VLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADL
ESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKL
GKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFAT
DDYDI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -