Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503828 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMED8 antibody: synthetic peptide directed towards the middle region of human TMED8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSY
SLLRN KTLYFHIYYT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
Petroziello J, Yamane A, Westendorf L, Thompson M, McDonagh C, Cerveny C, Law CL, Wahl A, Carter P
Oncogene 2004 Oct 7;23(46):7734-45
Oncogene 2004 Oct 7;23(46):7734-45
No comments: Submit comment
No validations: Submit validation data