HPA001205

TMED8 antibody from Sigma-Aldrich
FAM15B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001205
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001205, RRID:AB_2204460
Product name
Anti-TMED8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001205
Antibody type
Polyclonal
Antigen
Protein TMED8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQ
VLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADL
ESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKL
GKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFAT
DDYDI
Storage
-20C
Provider Type Product Number
- No reagents -