Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405964 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPS
SKSPW VESEYLDYLF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling.
Analysis of the variations in IL-28RA gene and their association with allergic rhinitis.
Mucha J, Majchrzak K, Taciak B, Hellmén E, Król M
PloS one 2014;9(7):e103249
PloS one 2014;9(7):e103249
Analysis of the variations in IL-28RA gene and their association with allergic rhinitis.
Chae SC, Park YR, Li CS, Lee JH, Yang YS, Zhang Q, Kim KS, Chung HT
Experimental & molecular medicine 2006 Jun 30;38(3):302-9
Experimental & molecular medicine 2006 Jun 30;38(3):302-9
No comments: Submit comment
No validations: Submit validation data