HPA017319

IFNLR1 antibody from Sigma-Aldrich
CRF2/12, IFNLR, IL-28R1, IL28RA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017319
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017319, RRID:AB_1851708
Product name
Anti-IL28RA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017319
Antibody type
Polyclonal
Antigen
Interleukin-28 receptor alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLD
LKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAA
SEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEA
N
Storage
-20C
Provider Type Product Number
- No reagents -