H00089782-B01

LMLN antibody from Abnova Corporation
Gp63, LMNL1, Msp

Antibody data

Product number
H00089782-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00089782-B01, RRID:AB_1576837
Product name
LMLN MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00089782-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LMLN protein.
Antigen sequence
MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSV
WVRSVLLLLGGLRASATSTPVSLGSSPPCRHHVPS
DTEVINKVHLKANHVVKRDVDEHLRIKTVYDKSVE
ELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTI
LLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPV
IVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDAD
FVLYVGALATERCSHENIISYAAYCQQEANMDRPI
AGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGF
SAGLFAFYHDKDGNPLTSRFADGLPPFNYSLGLYQ
WSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVE
EARKHFDCPVLEGMELENQGGVGTELNHWEKRLLE
NEAMTGSHTQNRVLSRITLALMEDTGRQMLSPYCD
TLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQ
YFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWH
LSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVC
LIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGL
KVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLC
PSCWDFCELCPPETDPPATNLTRALPLDLCSCSSS
LVVTLWLLLGNLFPLLAGFLLCIWH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -