HPA016481

LMLN antibody from Sigma-Aldrich
Gp63, Msp
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016481
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016481, RRID:AB_1852955
Product name
Anti-LMLN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016481
Antibody type
Polyclonal
Antigen
Leishmanolysin-like peptidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHR
YCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPH
GAVGVPDQEGISDADFVLYVGALATERCSHENIIS
YAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVG
MLS
Storage
-20C
Provider Type Product Number
- No reagents -