HPA027115

KLHL38 antibody from Sigma-Aldrich
C8ORFK36
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027115
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027115, RRID:AB_10599950
Product name
Anti-KLHL38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027115
Antibody type
Polyclonal
Antigen
kelch-like 38 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHPAFFHHFIANDALLQSSPACQIILETAKRQMFS
LCGTTVPDCKLLLHVPPRNSYQDFLILLGGRKDSQ
QTTRDVLLYSKQTGQWQ
Storage
-20C
Provider Type Product Number
- No reagents -