Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449823 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger, X-Linked, Duplicated A (ZXDA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the middle region of human ZXDA
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQ
KERNLITVTGSSFLV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The zinc finger proteins ZXDA and ZXDC form a complex that binds CIITA and regulates MHC II gene transcription.
Al-Kandari W, Koneni R, Navalgund V, Aleksandrova A, Jambunathan S, Fontes JD
Journal of molecular biology 2007 Jun 22;369(5):1175-87
Journal of molecular biology 2007 Jun 22;369(5):1175-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Muscle; WB Suggested Anti-ZXDA Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle; ZXDA antibody - middle region (AP43089PU-N) in Human Muscle cells using Western Blot