Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [3]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91170 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91170, RRID:AB_2665831
- Product name
- Anti-LAMP1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSS
CGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQ
LMSFVYNLSDTHLFPNASSKEIKTVESITDIRADI
DKKYRCVSGTQVHMNNVTVTLHDA- Isotype
- IgG
- Antibody clone number
- CL3484
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of HeLa cells using the Anti-LAMP1 monoclonal antibody, showing specific staining of lysosomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of MCF7 cells using the Anti-LAMP1 monoclonal antibody, showing specific staining of lysosomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U-251 cells using the Anti-LAMP1 monoclonal antibody, showing specific staining of lysosomes in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong granular cytoplasmic immunoreactivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows granular cytoplasmic positivity in epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows granular cytoplasmic immunoreactivity in epithelial and stromal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows only very low cytoplasmic immunoreactivity.