HPA027978

FAM91A1 antibody from Sigma-Aldrich
FLJ23790
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027978
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027978, RRID:AB_10600004
Product name
Anti-FAM91A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027978
Antibody type
Polyclonal
Antigen
family with sequence similarity 91, member A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQ
ILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDE
RGEPDLASGS
Storage
-20C
Provider Type Product Number
- No reagents -