HPA061199

C4orf33 antibody from Atlas Antibodies
FLJ33703
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA061199
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061199, RRID:AB_2684450
Product name
Anti-C4orf33
Provider product page
Atlas Antibodies - HPA061199
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSY
EALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLG
EEWKQPESDLWLI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -