HPA034834

EFHB antibody from MilliporeSigma / Merck KGaA
CFAP21, FLJ25200
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034834
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034834, RRID:AB_10601367
Product name
Anti-EFHB antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034834
Antibody type
Polyclonal
Antigen
EF-hand domain family, member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHELQMKRGAKFVSKRADDFKEKFQHKLGRVLDPI
AETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEY
LRGKDRQRALIAAVRHHLKKVN
Storage
-20C
Provider Type Product Number
- No reagents -