HPA014048

CYP4F2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014048
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014048, RRID:AB_1847452
Product name
Anti-CYP4F2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014048
Antibody type
Polyclonal
Antigen
Cytochrome P450 4F2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKV
WMGPISPLLSLCHPD
Storage
-20C
Provider Type Product Number
- No reagents -