Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011151-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011151-M01, RRID:AB_606085
- Product name
- CORO1A monoclonal antibody (M01), clone 4G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CORO1A.
- Antigen sequence
QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD
GYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDA
VSRLEEEMRKLQATVQELQKRLDRLEETVQAK- Isotype
- IgG
- Antibody clone number
- 4G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Coronin 1 regulates cognition and behavior through modulation of cAMP/protein kinase A signaling.
The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients.
Coronin-1 is associated with neutrophil survival and is cleaved during apoptosis: potential implication in neutrophils from cystic fibrosis patients.
Jayachandran R, Liu X, Bosedasgupta S, Müller P, Zhang CL, Moshous D, Studer V, Schneider J, Genoud C, Fossoud C, Gambino F, Khelfaoui M, Müller C, Bartholdi D, Rossez H, Stiess M, Houbaert X, Jaussi R, Frey D, Kammerer RA, Deupi X, de Villartay JP, Lüthi A, Humeau Y, Pieters J
PLoS biology 2014 Mar;12(3):e1001820
PLoS biology 2014 Mar;12(3):e1001820
The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients.
Federzoni EA, Humbert M, Valk PJ, Behre G, Leibundgut EO, Torbett BE, Fey MF, Tschan MP
British journal of haematology 2013 Mar;160(6):855-9
British journal of haematology 2013 Mar;160(6):855-9
Coronin-1 is associated with neutrophil survival and is cleaved during apoptosis: potential implication in neutrophils from cystic fibrosis patients.
Moriceau S, Kantari C, Mocek J, Davezac N, Gabillet J, Guerrera IC, Brouillard F, Tondelier D, Sermet-Gaudelus I, Danel C, Lenoir G, Daniel S, Edelman A, Witko-Sarsat V
Journal of immunology (Baltimore, Md. : 1950) 2009 Jun 1;182(11):7254-63
Journal of immunology (Baltimore, Md. : 1950) 2009 Jun 1;182(11):7254-63
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CORO1A monoclonal antibody (M01), clone 4G10 Western Blot analysis of CORO1A expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CORO1A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol