Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007919-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007919-A01, RRID:AB_489476
- Product name
- BAT1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant BAT1.
- Antigen sequence
RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYD
MPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAK
ILNDVQDRFEVNISELPDEIDISSYIEQTR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Murine leukemia virus uses TREX components for efficient nuclear export of unspliced viral transcripts.
Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
Requirement of UAP56, URH49, RBM15, and OTT3 in the expression of Kaposi sarcoma-associated herpesvirus ORF57.
A dual reporter approach to quantify defects in messenger RNA processing.
Sakuma T, Tonne JM, Ikeda Y
Viruses 2014 Mar 10;6(3):1135-48
Viruses 2014 Mar 10;6(3):1135-48
Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
Michelle L, Cloutier A, Toutant J, Shkreta L, Thibault P, Durand M, Garneau D, Gendron D, Lapointe E, Couture S, Le Hir H, Klinck R, Elela SA, Prinos P, Chabot B
Molecular and cellular biology 2012 Mar;32(5):954-67
Molecular and cellular biology 2012 Mar;32(5):954-67
Requirement of UAP56, URH49, RBM15, and OTT3 in the expression of Kaposi sarcoma-associated herpesvirus ORF57.
Majerciak V, Deng M, Zheng ZM
Virology 2010 Nov 25;407(2):206-12
Virology 2010 Nov 25;407(2):206-12
A dual reporter approach to quantify defects in messenger RNA processing.
Banerjee A, Sammarco MC, Ditch S, Grabczyk E
Analytical biochemistry 2009 Dec 15;395(2):237-43
Analytical biochemistry 2009 Dec 15;395(2):237-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BAT1 polyclonal antibody (A01), Lot # GTH0060529QCS1 Western Blot analysis of BAT1 expression in Hela S3 NE ( Cat # L013V3 ).