Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183334 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39B (DDX39B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the C terminal of human BAT1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDEND
AKILN DVQDRFEVNI- Vial size
- 50 µg
Submitted references Proteomic analysis of BRCA1-depleted cell line reveals a putative role for replication protein A2 up-regulation in BRCA1 breast tumor development.
The central MHC gene, BAT1, may encode a protein that down-regulates cytokine production.
Bouley J, Pionneau C, Varinot J, Biard D, Genestie C, Antoine M, Coulet F, Stern MH, Stoppa-Lyonnet D, Soubrier F
Proteomics. Clinical applications 2010 May;4(5):489-98
Proteomics. Clinical applications 2010 May;4(5):489-98
The central MHC gene, BAT1, may encode a protein that down-regulates cytokine production.
Allcock RJ, Williams JH, Price P
Genes to cells : devoted to molecular & cellular mechanisms 2001 May;6(5):487-94
Genes to cells : devoted to molecular & cellular mechanisms 2001 May;6(5):487-94
No comments: Submit comment
No validations: Submit validation data