HPA013760

MINAR2 antibody from Sigma-Aldrich
KIAA1024L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013760
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013760, RRID:AB_1852363
Product name
Anti-KIAA1024L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013760
Antibody type
Polyclonal
Antigen
UPF0258 protein KIAA1024-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKNNPLYGDLSLEEAMEERKKNPSWTIEEYDKHSL
HTNLSGHLKENPNDLRFWLGDMYTPGFDTLLKKEE
KQEKHSKFCRM
Storage
-20C
Provider Type Product Number
- No reagents -