HPA015570

CD300E antibody from Sigma-Aldrich
CD300LE, CLM2, IREM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015570, RRID:AB_1846294
Product name
Anti-CD300E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015570
Antibody type
Polyclonal
Antigen
CMRF35-like molecule 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGE
EKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSY
WCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRT
THPATPPIFLVVNPGRNLSTGEVLTQNSGFR
Storage
-20C
Provider Type Product Number
- No reagents -