Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010652-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010652-M03, RRID:AB_1581976
- Product name
- YKT6 monoclonal antibody (M03), clone 1F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant YKT6.
- Antigen sequence
DEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNP
READPMTKVQAELDETKIILHNTMESLLERGEKLD
DLVSKSEVLGTQSKAFYKTARKQNSCCAIM- Isotype
- IgG
- Antibody clone number
- 1F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- YKT6 monoclonal antibody (M03), clone 1F8. Western Blot analysis of YKT6 expression in MCF-7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of YKT6 expression in transfected 293T cell line by YKT6 monoclonal antibody (M03), clone 1F8.Lane 1: YKT6 transfected lysate (Predicted MW: 22.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to YKT6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol