HPA030818

YKT6 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030818
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030818, RRID:AB_10602102
Product name
Anti-YKT6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030818
Antibody type
Polyclonal
Antigen
YKT6 v-SNARE homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPREADPMTKVQAELDETKIILHNTMESLLERGEK
LDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM
Storage
-20C
Provider Type Product Number
- No reagents -