Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29489 - Provider product page

- Provider
- Abnova Corporation
- Product name
- FCAR polyclonal antibody
- Antibody type
- Polyclonal
- Description
- FCAR polyclonal antibody raised against recombinant human FCAR.
- Antigen sequence
NWHSHTALNKEASADVAEPSWSQQMCQPGLTFART
PSVCK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, with FCAR polyclonal antibody (Cat# PAB29489) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of U-251 MG cells with FCAR polyclonal antibody (Cat# PAB29489) under 1-4 ug/mL working concentration shows positivity in vesicles. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with FCAR polyclonal antibody (Cat# PAB29489) shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)