HPA014050

FCAR antibody from Sigma-Aldrich
CD89
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014050
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014050, RRID:AB_1846338
Product name
Anti-FCAR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014050
Antibody type
Polyclonal
Antigen
Immunoglobulin alpha Fc receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NWHSHTALNKEASADVAEPSWSQQMCQPGLTFART
PSVCK
Storage
-20C
Provider Type Product Number
- No reagents -