SAB1401131

FCAR antibody from Sigma-Aldrich
CD89
No application information provided.

Antibody data

Product number
SAB1401131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401131, RRID:AB_10607996
Product name
Anti-FCAR antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401131
Antibody type
Polyclonal
Antigen
FCAR (NP_001991.1, 1 a.a. ~ 287 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKS
SPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE
IGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIG
HYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGE
NISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHP
ANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNA
LELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAIL
VENWHSHTAL
Storage
-20C
Provider Type Product Number
- No reagents -