Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009788-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009788-M01, RRID:AB_606615
- Product name
- MTSS1 monoclonal antibody (M01), clone 2G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTSS1.
- Antigen sequence
GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPS
SMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAED
QEREPPSATVSPGQIPESDPADLSPRDTPQ- Isotype
- IgG
- Antibody clone number
- 2G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MTSS1 is a metastasis driver in a subset of human melanomas.
Anti-miR182 reduces ovarian cancer burden, invasion, and metastasis: an in vivo study in orthotopic xenografts of nude mice.
The impact of Metastasis Suppressor-1, MTSS1, on oesophageal squamous cell carcinoma and its clinical significance.
Downregulation of metastasis suppressor 1(MTSS1) is associated with nodal metastasis and poor outcome in Chinese patients with gastric cancer.
Metastasis suppressor 1 (MTSS1) demonstrates prognostic value and anti-metastatic properties in breast cancer.
Mertz KD, Pathria G, Wagner C, Saarikangas J, Sboner A, Romanov J, Gschaider M, Lenz F, Neumann F, Schreiner W, Nemethova M, Glassmann A, Lappalainen P, Stingl G, Small JV, Fink D, Chin L, Wagner SN
Nature communications 2014 Mar 17;5:3465
Nature communications 2014 Mar 17;5:3465
Anti-miR182 reduces ovarian cancer burden, invasion, and metastasis: an in vivo study in orthotopic xenografts of nude mice.
Xu X, Ayub B, Liu Z, Serna VA, Qiang W, Liu Y, Hernando E, Zabludoff S, Kurita T, Kong B, Wei JJ
Molecular cancer therapeutics 2014 Jul;13(7):1729-39
Molecular cancer therapeutics 2014 Jul;13(7):1729-39
The impact of Metastasis Suppressor-1, MTSS1, on oesophageal squamous cell carcinoma and its clinical significance.
Xie F, Ye L, Chen J, Wu N, Zhang Z, Yang Y, Zhang L, Jiang WG
Journal of translational medicine 2011 Jun 22;9:95
Journal of translational medicine 2011 Jun 22;9:95
Downregulation of metastasis suppressor 1(MTSS1) is associated with nodal metastasis and poor outcome in Chinese patients with gastric cancer.
Liu K, Wang G, Ding H, Chen Y, Yu G, Wang J
BMC cancer 2010 Aug 15;10:428
BMC cancer 2010 Aug 15;10:428
Metastasis suppressor 1 (MTSS1) demonstrates prognostic value and anti-metastatic properties in breast cancer.
Parr C, Jiang WG
European journal of cancer (Oxford, England : 1990) 2009 Jun;45(9):1673-83
European journal of cancer (Oxford, England : 1990) 2009 Jun;45(9):1673-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MTSS1 monoclonal antibody (M01), clone 2G9. Western Blot analysis of MTSS1 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTSS1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MTSS1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol