H00005104-B01P

SERPINA5 antibody from Abnova Corporation
PAI3, PCI, PLANH3, PROCI

Antibody data

Product number
H00005104-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005104-B01P, RRID:AB_1237944
Product name
SERPINA5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00005104-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SERPINA5 protein.
Antigen sequence
MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLH
VGATVAPSSRRDFTFDLYRALASAAPSQNIFFSPV
SISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEK
ELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVD
LQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDY
VAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWE
TSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYL
LDRNLSCRVVGVPYQGNATALFILPSEGKMQQVEN
GLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLE
KVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHK
AVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFN
RPFLMFIVDNNILFLGKVNRP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -