Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311581 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERPINA5 antibody: synthetic peptide directed towards the C terminal of human SERPINA5
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGT
RAAAA TGTIFTFRSA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular basis of thrombin recognition by protein C inhibitor revealed by the 1.6-A structure of the heparin-bridged complex.
Li W, Adams TE, Nangalia J, Esmon CT, Huntington JA
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 25;105(12):4661-6
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 25;105(12):4661-6
No comments: Submit comment
No validations: Submit validation data