HPA015571

TMPRSS12 antibody from Sigma-Aldrich
CT151, MGC57341
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015571
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015571, RRID:AB_2303539
Product name
Anti-TMPRSS12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015571
Antibody type
Polyclonal
Antigen
Transmembrane protease, serine 12 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PICLPFDVFQILDGNTKCFISGWGRTKEEGNATNI
LQDAEVHYISREMCNSERSYGGIIPNTSFCAGDED
GAFDTCRGDSGGPLMCYLPEYKRFFVMGITSYGHG
CGRRGFPGVYIGPSF
Storage
-20C
Provider Type Product Number
- No reagents -