H00153527-B01

ZMAT2 antibody from Abnova Corporation
FLJ31121, hSNU23, Snu23

Antibody data

Product number
H00153527-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00153527-B01, RRID:AB_1139145
Product name
ZMAT2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00153527-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZMAT2 protein.
Antigen sequence
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREK
KDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITK
TTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQ
RNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY
DFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDL
TFEEDDEMAAVMGFSGFGSTKKSY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -